- Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA2 (RMA2)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1189248
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 22,178 Da
- E Coli or Yeast
- 1-193
- RING membrane-anchor 2, ATRMA2, F26K10.150, F26K10_150
- E3 ubiquitin-protein ligase RMA2 (RMA2)
Sequence
MEIEKDEDDTTLVDSGGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSEATLVPIYGRGQKAPQSGSNVPSRPTGPVYDLRGVGQRLGEGESQRYMYRMPDPVMGVVCEMVYRRLFGESSSNMAPYRDMNVRSRRRAMQAEESLSRVYLFLLCFMFMCLFLF